PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast02G021600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family TALE
Protein Properties Length: 315aa    MW: 34834.4 Da    PI: 6.1902
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast02G021600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.31.1e-072642972154
                         HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
            Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                         k +yp+++++++L +++gL+ +q+ +WF N+R +
  Brast02G021600.1.p 264 KWPYPTEDDKAKLVEETGLQLKQINNWFINQRKR 297
                         469*****************************87 PP

2ELK27.76.2e-10218239122
                 ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                         ELK +L++++++++g++++E++
  Brast02G021600.1.p 218 ELKIELKQGFKSRIGDVREEIL 239
                         9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.0E-134892IPR005540KNOX1
PfamPF037902.0E-135090IPR005540KNOX1
SMARTSM012562.5E-23103158IPR005541KNOX2
PfamPF037913.8E-18106157IPR005541KNOX2
PfamPF037892.2E-6218239IPR005539ELK domain
PROSITE profilePS512139.289218238IPR005539ELK domain
SMARTSM011880.0049218239IPR005539ELK domain
PROSITE profilePS5007111.693238301IPR001356Homeobox domain
SMARTSM003894.9E-10240305IPR001356Homeobox domain
SuperFamilySSF466895.56E-16240304IPR009057Homeodomain-like
CDDcd000862.28E-11241302No hitNo description
Gene3DG3DSA:1.10.10.604.8E-25245304IPR009057Homeodomain-like
PfamPF059201.1E-17258297IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010089Biological Processxylem development
GO:0010192Biological Processmucilage biosynthetic process
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MLQGDHQLLG GEGGGTMEMG SFGGGECSSS SAAAAAAVTA AAEAEERQLL KGEMAVHPLC  60
EQLVAAHVGC LRVATPIDHL PIIDAQLAQS GGLLHSYAAH HRPFLSPHDK QDLDSFLAQY  120
LMLLCSFREQ LQQHVRVHAV EAVMACREIE QSLQDLTGAT LEEGTGATMS EDEEEPQTIM  180
EAAAAAMDMS SNGHDMMGFG PLVPTDSERS LMERVRQELK IELKQGFKSR IGDVREEILR  240
KRRAGKLPGD TTTILKQWWQ QHSKWPYPTE DDKAKLVEET GLQLKQINNW FINQRKRNWH  300
NNSQTSTLKS KRKR*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1294313RKRNWHNNSQTSTLKSKRKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP1004270.0FP100427.1 Phyllostachys edulis cDNA clone: bphyem121o22, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003558936.20.0PREDICTED: homeobox protein knotted-1-like 3
SwissprotQ94LW30.0KNOS3_ORYSJ; Homeobox protein knotted-1-like 3
TrEMBLI1HAC30.0I1HAC3_BRADI; Uncharacterized protein
STRINGBRADI1G76970.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56438169
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62990.11e-135KNOTTED-like homeobox of Arabidopsis thaliana 7